PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc06855.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 210aa    MW: 24277.2 Da    PI: 9.5201
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc06855.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.61.2e-111150342
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  i nks r   f kR++ + K A+ L +LC+++++v+++++
  Zpz_sc06855.1.g00010.1.am.mk 11 IGNKSIRRAAFRKRQASLVKMASDLTTLCGIKACVVVYGE 50
                                  88************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.769150IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-15174IPR002100Transcription factor, MADS-box
SMARTSM004326.4E-9160IPR002100Transcription factor, MADS-box
CDDcd002664.30E-21275No hitNo description
PfamPF003192.5E-111151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MAPKKVNLQW IGNKSIRRAA FRKRQASLVK MASDLTTLCG IKACVVVYGE GKSQPEVWPS  60
VPEAKQLIHH FNAMPDNLGS YKKTLNQEDF LCNRISNLHY QMSKFDHENY EYETLFLLHK  120
TMAGHQTNLA GLTNQDLISI KCMVEAKTKK IKERLQQLDI KKGQILQEPL VHPLLFSSQQ  180
QGDPMYMERY IPMLTKEPQL EQHDFLPRHA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451085.18e-56hypothetical protein SORBIDRAFT_05g023895
TrEMBLC5Y5X69e-56C5Y5X6_SORBI; Putative uncharacterized protein Sb05g023895
STRINGSb05g023895.13e-55(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.22e-22M-type_MADS family protein